PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1663420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 227aa    MW: 26122.4 Da    PI: 9.4621
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1663420.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.51.7e-2193152357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Lj1g3v1663420.1  93 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQITAQLskygKIEGKNVFYWFQNHKARERQ 152
                      7*****************99**************************************97 PP

2Wus_type_Homeobox119.71.2e-3893154465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+ly+ G+rtPn+++i++ita+L++yGkie+kNVfyWFQN+kaRerqkq
    Lj1g3v1663420.1  93 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLSKYGKIEGKNVFYWFQNHKARERQKQ 154
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.18788153IPR001356Homeobox domain
SuperFamilySSF466891.84E-1289159IPR009057Homeodomain-like
SMARTSM003898.3E-790157IPR001356Homeobox domain
CDDcd000862.11E-493154No hitNo description
PfamPF000463.4E-1993152IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-794152IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MGSMKVHQFT RGFWEHEPSL TLGCKRLRPL APKLPNTTDT TAAATTTTTH SLPFDIKSFI  60
RPESGPIKLL SSDDNKKDPP SPQSQVETHP GGTRWNPTQE QIGILEMLYR GGMRTPNAQQ  120
IEQITAQLSK YGKIEGKNVF YWFQNHKARE RQKQKRNSLG LSHSPRTSTI QTISLETRRG  180
EVVERDEEDS PYKRCRRWGF ECLEEQIGNK EEEHRTLELF PLHPEGR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.179030.0cell culture| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1342930.0BT134293.1 Lotus japonicus clone JCVI-FLLj-7G1 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241420.11e-129uncharacterized protein LOC100781015
SwissprotQ6X7J97e-77WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLI3S1E61e-170I3S1E6_LOTJA; Uncharacterized protein
STRINGGLYMA06G04470.11e-129(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.12e-74WUSCHEL related homeobox 4